PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00034.1.g05970.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 323aa    MW: 34436.5 Da    PI: 4.7198
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00034.1.g05970.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-383389662
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                   +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++s+
  Zjn_sc00034.1.g05970.1.am.mk 33 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRSK 89
                                  68***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-341682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.773387IPR003851Zinc finger, Dof-type
PfamPF027016.5E-323387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MLSSHHEAMM PYAPLPPSLL VDRRYKQGAE VAPNCPRCDS PNTKFCYYNN YSLSQPRYFC  60
KGCRRYWTKG GSLRNVPVGG GCRKSRRSKS SVRLTAVSIS GGRDAAFGNQ FPGPVRPDLV  120
LESMVSNPAN PGQAMPDVSS SGDGSSIDLA MLYAKFLNNP PADASVGAVT PESAGKMDKA  180
FDTFSVSSDL SPSVLAPGAQ LDPCHDGFGE WSGPVSSSDP NSTTSTTATT TMLCADVSVQ  240
AALGELNFAM DQSCFDSIGL PADVDNLSSW CSIVPSLSTL EDTKYDSLVS FPDDALSLHE  300
GMMNGPHHDW SVDCQGLEAL YMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970693.10.0PREDICTED: uncharacterized protein LOC101752604
TrEMBLK3XK070.0K3XK07_SETIT; Uncharacterized protein
STRINGSi002230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-35Dof family protein